ARL2 (NM_001667) Human Recombinant Protein

SKU TP300501L

Recombinant protein of human ADP-ribosylation factor-like 2 (ARL2), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200501 protein sequence; Red=Cloning site Green=Tags(s); ; MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQ; KSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE; VLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001658
• Locus ID: 402
• UniProt ID: P36404
• Cytogenetics: 11q13.1
• RefSeq Size: 993
• RefSeq ORF: 552
• Synonyms: ARFL2
• Summary: This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. [provided by RefSeq, Jul 2008]