SGT1 (ECD) (NM_007265) Human Recombinant Protein

SKU
TP300384
Recombinant protein of human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200384 protein sequence
Red=Cloning site Green=Tags(s)

MEETMKLATMEDTVEYCLFLIPDESRDSDKHKEILQKYIERIITRFAPMLVPYIWQNQPFNLKYKPGKGG
VPAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPENSTNRVFF
CHGELCIIPAPRKSGAESWLPTTPPTIPQALNIITAHSEKILASESIRAAVNRRIRGYPEKIQASLHRAH
CFLPAGIVAVLKQRPRLVAAAVQAFYLRDPIDLRACRVFKTFLPETRIMTSVTFTKCLYAQLVQQRFVPD
RRSGYRLPPPSDPQYRAHELGMKLAHGFEILCSKCSPHFSDCKKSLVTASPLWASFLESLKKNDYFKGLI
EGSAQYRERLEMAENYFQLSVDWPESSLAMSPGEEILTLLQTIPFDIEDLKKEAANLPPEDDDQWLDLSP
DQLDQLLQEAVGKKESESVSKEEKEQNYDLTEVSESMKAFISKVSTHKGAELPREPSEAPITFDADSFLN
YFDKILGPRPNESDSDDLDDEDFECLDSDDDLDFETHEPGEEASLKGTLDNLKSYMAQMDQELAHTCISK
SFTTRNQVEPVSQTTDNNSDEEDSGTGESVMAPVDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLP
DNTDHRPTSKPTKN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 72.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009196
Locus ID 11319
UniProt ID O95905
Cytogenetics 10q22.2
RefSeq Size 2280
RefSeq ORF 1932
Synonyms GCR2; HSGT1; SGT1
Summary Regulator of p53/TP53 stability and function. Inhibits MDM2-mediated degradation of p53/TP53 possibly by cooperating in part with TXNIP (PubMed:16849563, PubMed:23880345). May be involved transcriptional regulation. In vitro has intrinsic transactivation activity enhanced by EP300. May be a transcriptional activator required for the expression of glycolytic genes (PubMed:19919181, PubMed:9928932). Involved in regulation of cell cycle progression. Proposed to disrupt Rb-E2F binding leading to transcriptional activation of E2F proteins (PubMed:19640839). The cell cycle -regulating function may depend on its RUVBL1-mediated association with the R2TP complex (PubMed:26711270). May play a role in regulation of pre-mRNA splicing (PubMed:24722212).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:SGT1 (ECD) (NM_007265) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300384 ECD MS Standard C13 and N15-labeled recombinant protein (NP_009196) 10 ug
$3,255.00
LC416084 ECD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427697 ECD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416084 Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 1 100 ug
$436.00
LY427697 Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 2 100 ug
$665.00
TP762522 Purified recombinant protein of Human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, full length, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.