SGT1 (ECD) (NM_007265) Human Mass Spec Standard

SKU
PH300384
ECD MS Standard C13 and N15-labeled recombinant protein (NP_009196)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200384]
Predicted MW 72.8 kDa
Protein Sequence
Protein Sequence
>RC200384 protein sequence
Red=Cloning site Green=Tags(s)

MEETMKLATMEDTVEYCLFLIPDESRDSDKHKEILQKYIERIITRFAPMLVPYIWQNQPFNLKYKPGKGG
VPAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPENSTNRVFF
CHGELCIIPAPRKSGAESWLPTTPPTIPQALNIITAHSEKILASESIRAAVNRRIRGYPEKIQASLHRAH
CFLPAGIVAVLKQRPRLVAAAVQAFYLRDPIDLRACRVFKTFLPETRIMTSVTFTKCLYAQLVQQRFVPD
RRSGYRLPPPSDPQYRAHELGMKLAHGFEILCSKCSPHFSDCKKSLVTASPLWASFLESLKKNDYFKGLI
EGSAQYRERLEMAENYFQLSVDWPESSLAMSPGEEILTLLQTIPFDIEDLKKEAANLPPEDDDQWLDLSP
DQLDQLLQEAVGKKESESVSKEEKEQNYDLTEVSESMKAFISKVSTHKGAELPREPSEAPITFDADSFLN
YFDKILGPRPNESDSDDLDDEDFECLDSDDDLDFETHEPGEEASLKGTLDNLKSYMAQMDQELAHTCISK
SFTTRNQVEPVSQTTDNNSDEEDSGTGESVMAPVDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLP
DNTDHRPTSKPTKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009196
RefSeq Size 2280
RefSeq ORF 1932
Synonyms GCR2; HSGT1; SGT1
Locus ID 11319
UniProt ID O95905
Cytogenetics 10q22.2
Summary Regulator of p53/TP53 stability and function. Inhibits MDM2-mediated degradation of p53/TP53 possibly by cooperating in part with TXNIP (PubMed:16849563, PubMed:23880345). May be involved transcriptional regulation. In vitro has intrinsic transactivation activity enhanced by EP300. May be a transcriptional activator required for the expression of glycolytic genes (PubMed:19919181, PubMed:9928932). Involved in regulation of cell cycle progression. Proposed to disrupt Rb-E2F binding leading to transcriptional activation of E2F proteins (PubMed:19640839). The cell cycle -regulating function may depend on its RUVBL1-mediated association with the R2TP complex (PubMed:26711270). May play a role in regulation of pre-mRNA splicing (PubMed:24722212).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:SGT1 (ECD) (NM_007265) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416084 ECD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427697 ECD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416084 Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 1 100 ug
$436.00
LY427697 Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 2 100 ug
$665.00
TP300384 Recombinant protein of human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, 20 µg 20 ug
$867.00
TP762522 Purified recombinant protein of Human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, full length, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.