CLEC4E (NM_014358) Human Recombinant Protein

CAT#: TP300244L

Recombinant protein of human C-type lectin domain family 4, member E (CLEC4E)

Size: 20 ug 100 ug 1 mg



USD 9,200.00

9 Weeks*

Size
    • 1 mg

Product Images

Frequently bought together (2)
CLEC4E mouse monoclonal antibody,clone 2H4, HRP conjugated
    • 100 ul

USD 509.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "CLEC4E"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200244 protein sequence
Red=Cloning site Green=Tags(s)

MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN
YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG
LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI
NPLNKGKSL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.9 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Applications Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_055173
Locus ID 26253
UniProt ID Q9ULY5
Cytogenetics 12p13.31
Refseq Size 2158
Refseq ORF 657
Synonyms CLECSF9; MINCLE
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.