TMEM38B (NM_018112) Human Recombinant Protein

SKU
TP300137
Recombinant protein of human transmembrane protein 38B (TMEM38B), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200137 protein sequence
Red=Cloning site Green=Tags(s)

MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISSWFTAMLHCFGGGILSCLLLA
EPPLKFLANHTNILLASSIWYITFFCPHDLVSQGYSYLPVQLLASGMKEVTRTWKIVGGVTHANSYYKNG
WIVMIAIGWARGAGGTIITNFERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMF
LYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASD
NVKKKHTKKNE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060582
Locus ID 55151
UniProt ID Q9NVV0
Cytogenetics 9q31.2
RefSeq Size 3558
RefSeq ORF 873
Synonyms bA219P18.1; C9orf87; D4Ertd89e; OI14; TRIC-B; TRICB
Summary This gene encodes an intracellular monovalent cation channel that functions in maintenance of intracellular calcium release. Mutations in this gene may be associated with autosomal recessive osteogenesis. [provided by RefSeq, Oct 2012]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM38B (NM_018112) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300137 TMEM38B MS Standard C13 and N15-labeled recombinant protein (NP_060582) 10 ug
$3,255.00
LC413299 TMEM38B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413299 Transient overexpression lysate of transmembrane protein 38B (TMEM38B) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.