DNAJC17 (NM_018163) Human Recombinant Protein

SKU
TP300130
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 17 (DNAJC17), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200130 protein sequence
Red=Cloning site Green=Tags(s)

MAVTKELLQMDLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARA
AYDKVRKAKKQAAERTQKLDEKRKKVKLDLEARERQAQAQESEEEEESRSTRTLEQEIERLREEGSRQLE
EQQRLIREQIRQERDQRLRGKAENTEGQGTPKLKLKWKCKKEDESKGGYSKDVLLRLLQKYGEVLNLVLS
SKKPGTAVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMR
MRQAAERQQLIARMQQEDQEGPPT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060633
Locus ID 55192
UniProt ID Q9NVM6
Cytogenetics 15q15.1
RefSeq Size 1031
RefSeq ORF 912
Summary May negatively affect PAX8-induced thyroglobulin/TG transcription.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DNAJC17 (NM_018163) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300130 DNAJC17 MS Standard C13 and N15-labeled recombinant protein (NP_060633) 10 ug
$3,255.00
LC413260 DNAJC17 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413260 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 17 (DNAJC17) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.