ADI1 (NM_018269) Human Recombinant Protein

SKU
TP300115
Recombinant protein of human acireductone dioxygenase 1 (ADI1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200115 protein sequence
Red=Cloning site Green=Tags(s)

MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC
KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK
NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060739
Locus ID 55256
UniProt ID Q9BV57
Cytogenetics 2p25.3
RefSeq Size 1685
RefSeq ORF 537
Synonyms APL1; ARD; Fe-ARD; HMFT1638; MTCBP1; mtnD; Ni-ARD; SIPL
Summary This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:ADI1 (NM_018269) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300115 ADI1 MS Standard C13 and N15-labeled recombinant protein (NP_060739) 10 ug
$3,255.00
LC402662 ADI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402662 Transient overexpression lysate of acireductone dioxygenase 1 (ADI1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.