GAL4 (LGALS4) (NM_006149) Human Recombinant Protein

SKU
TP300026
Recombinant protein of human lectin, galactoside-binding, soluble, 4 (LGALS4), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200026 representing NM_006149
Red=Cloning site Green=Tags(s)

MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDG
WDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDG
DLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIII
KGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRC
GLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006140
Locus ID 3960
UniProt ID P56470
Cytogenetics 19q13.2
RefSeq Size 1117
RefSeq ORF 969
Synonyms GAL4; L36LBP
Summary The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GAL4 (LGALS4) (NM_006149) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300026 LGALS4 MS Standard C13 and N15-labeled recombinant protein (NP_006140) 10 ug
$3,255.00
LC416836 LGALS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416836 Transient overexpression lysate of lectin, galactoside-binding, soluble, 4 (LGALS4) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.