SNRNP25 (NM_024571) Human Recombinant Protein

CAT#: TP300010

Recombinant protein of human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25), 20 µg

Product Images

Coomassie blue staining of purified SNRNP25 protein (Cat# TP300010). The protein was produced from HEK293T cells transfected with SNRNP25 cDNA clone (Cat# RC200010) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC200010
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKA
  IQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK
  myc-FLAG tag
  
  Recombinant protein using RC200010 also available, TP300010
• Tag: C-Myc/DDK
• Predicted MW: 15.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078847
• Locus ID: 79622
• UniProt ID: Q9BV90, Q4TT61
• Cytogenetics: 16p13.3
• Refseq Size: 1103
• Refseq ORF: 396
• Synonyms: C16orf33
• Summary: Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010]
• Protein Families: Druggable Genome