OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NELL2 (NM_001145110) Human Mass Spec Standard

Be the first to review this product
SKU
PH327981
NELL2 MS Standard C13 and N15-labeled recombinant protein (NP_001138582)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339034 Rabbit Polyclonal Anti-NELL2 Antibody
100 ul
$525.00
LY428697 Transient overexpression lysate of NEL-like 2 (chicken) (NELL2), transcript variant 5 (as WB positive control) 100 ug
$665.00

Other products for "NELL2 or NM_001145110"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227981
Predicted MW 94 kDa
Protein Sequence
Protein Sequence
>RC227981 representing NM_001145110
Red=Cloning site Green=Tags(s)

MSIRRLLILILKIGRRWTELIRTMESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQ
VPGLHNGTKAFLFQDTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELE
SSGHRNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPSTDLPLGT
TFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKIMELQDILAKTSAKLSR
AEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCC
KECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKG
YDFCSERHNCMENSICRNLNDRAVCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCI
CKTGYIRIDDYSCTEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIA
ANVCACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCEDIDECG
TGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRCSVCSCQNGFVMCRRMVC
DCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQQCRCLQGEVDCWPLPCPDVECEFSILP
ENECCPRCVTDPCQADTIRNDITKTCLDEMNVVRFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138582
RefSeq ORF 2517
Synonyms NRP2
Locus ID 4753
UniProt ID Q99435
Cytogenetics 12q12
Summary The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. provided by RefSeq, Feb 2009
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NELL2" proteins (7)
SKU Description Size Price
LC416830 Lyophilized NELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428694 Lyophilized NELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428697 Lyophilized NELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416830 Transient overexpression lysate of NEL-like 2 (chicken) (NELL2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428694 Transient overexpression lysate of NEL-like 2 (chicken) (NELL2), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY428697 Transient overexpression lysate of NEL-like 2 (chicken) (NELL2), transcript variant 5 (as WB positive control) 100 ug
$665.00
TP327981 Recombinant protein of human NEL-like 2 (chicken) (NELL2), transcript variant 5, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products