NELL2 (NM_001145110) Human Mass Spec Standard

SKU
PH327981
NELL2 MS Standard C13 and N15-labeled recombinant protein (NP_001138582)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227981]
Predicted MW 94 kDa
Protein Sequence
Protein Sequence
>RC227981 representing NM_001145110
Red=Cloning site Green=Tags(s)

MSIRRLLILILKIGRRWTELIRTMESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQ
VPGLHNGTKAFLFQDTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELE
SSGHRNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPSTDLPLGT
TFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKIMELQDILAKTSAKLSR
AEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCC
KECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKG
YDFCSERHNCMENSICRNLNDRAVCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCI
CKTGYIRIDDYSCTEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIA
ANVCACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCEDIDECG
TGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRCSVCSCQNGFVMCRRMVC
DCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQQCRCLQGEVDCWPLPCPDVECEFSILP
ENECCPRCVTDPCQADTIRNDITKTCLDEMNVVRFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138582
RefSeq ORF 2517
Synonyms NRP2
Locus ID 4753
UniProt ID Q99435
Cytogenetics 12q12
Summary The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. [provided by RefSeq, Feb 2009]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:NELL2 (NM_001145110) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416830 NELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428694 NELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428697 NELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416830 Transient overexpression lysate of NEL-like 2 (chicken) (NELL2), transcript variant 2 100 ug
$436.00
LY428694 Transient overexpression lysate of NEL-like 2 (chicken) (NELL2), transcript variant 1 100 ug
$665.00
LY428697 Transient overexpression lysate of NEL-like 2 (chicken) (NELL2), transcript variant 5 100 ug
$665.00
TP327981 Recombinant protein of human NEL-like 2 (chicken) (NELL2), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.