MTFR1 (NM_001145838) Human Mass Spec Standard

SKU
PH327926
MTFR1 MS Standard C13 and N15-labeled recombinant protein (NP_001139310)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227926]
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC227926 representing NM_001145838
Red=Cloning site Green=Tags(s)

MLGWIKRLIRMVFQQVGVSMQSINSHATEWSPSHPGEDAVASFADVGWVAKEEGECSARLRTEVRSRPPL
QDDLLFFEKAPSRQISLPDLSQEEPQLKTPALANEEALQKICALENELAALRAQIAKIVTQQEQQNLTAG
DLDSTTFGTIPPHPPPPPPPLPPPALGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILK
EMNSVKLRSVKRSEQDVKPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFG
PHMLKPTGKMKALIENVSDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139310
RefSeq ORF 900
Synonyms CHPPR; FAM54A2
Locus ID 9650
UniProt ID Q15390
Cytogenetics 8q13.1
Summary This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:MTFR1 (NM_001145838) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415142 MTFR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429023 MTFR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415142 Transient overexpression lysate of mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY429023 Transient overexpression lysate of mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
TP327926 Purified recombinant protein of Homo sapiens mitochondrial fission regulator 1 (MTFR1), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.