GKAP1 (NM_001135953) Human Mass Spec Standard

SKU
PH327915
GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001129425)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227915]
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC227915 representing NM_001135953
Red=Cloning site Green=Tags(s)

MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA
NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE
YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEEVVLKDGRIERLKLE
LERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHA
ALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129425
RefSeq ORF 945
Synonyms FKSG21; GKAP42
Locus ID 80318
UniProt ID Q5VSY0
Cytogenetics 9q21.32
Summary This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:GKAP1 (NM_001135953) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304911 GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_079487) 10 ug
$3,255.00
LC410835 GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427741 GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410835 Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 1 100 ug
$436.00
LY427741 Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 2 100 ug
$436.00
TP304911 Recombinant protein of human G kinase anchoring protein 1 (GKAP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327915 Purified recombinant protein of Homo sapiens G kinase anchoring protein 1 (GKAP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761516 Purified recombinant protein of Human G kinase anchoring protein 1 (GKAP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.