OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GKAP1 (NM_001135953) Human Mass Spec Standard

Be the first to review this product
SKU
PH327915
GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001129425)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370359 GKAP1 rabbit polyclonal antibody
100 ul
$310.00
LY410835 Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GKAP1 or NM_001135953"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227915
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC227915 representing NM_001135953
Red=Cloning site Green=Tags(s)

MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA
NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE
YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEEVVLKDGRIERLKLE
LERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHA
ALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129425
RefSeq ORF 945
Synonyms FKSG21; GKAP42
Locus ID 80318
UniProt ID Q5VSY0
Cytogenetics 9q21.32
Summary This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GKAP1" proteins (8)
SKU Description Size Price
PH304911 GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_079487) 10 ug
$3,360.00
LC410835 Lyophilized GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427741 Lyophilized GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410835 Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427741 Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304911 Recombinant protein of human G kinase anchoring protein 1 (GKAP1), transcript variant 1, 20 µg 20 ug
$867.00
TP327915 Purified recombinant protein of Homo sapiens G kinase anchoring protein 1 (GKAP1), transcript variant 2, 20 µg 20 ug
$867.00
TP761516 Purified recombinant protein of Human G kinase anchoring protein 1 (GKAP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products