Apoptosis inhibitor 5 (API5) (NM_001142931) Human Mass Spec Standard

SKU
PH327863
API5 MS Standard C13 and N15-labeled recombinant protein (NP_001136403)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227863]
Predicted MW 50.6 kDa
Protein Sequence
Protein Sequence
>RC227863 representing NM_001142931
Red=Cloning site Green=Tags(s)

MPTVEELYRNYGILADATEQVGQIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVNNALLSI
FKMDAKGTLGGLFSQILQGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTGEEFVLF
MKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCE
QVLPNLGTLTTPVEGLDIQLEVLKLLAEMSSFCGDMEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNE
EPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALK
TEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPK
RDARQIYNPPSGKYSSNLGNFNYERSLQGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001136403
RefSeq ORF 1350
Synonyms AAC-11; AAC11
Locus ID 8539
UniProt ID Q9BZZ5
Cytogenetics 11p12
Summary This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Apoptosis inhibitor 5 (API5) (NM_001142931) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC428299 API5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY428299 Transient overexpression lysate of apoptosis inhibitor 5 (API5), transcript variant 3 100 ug
$436.00
TP327863 Recombinant protein of human apoptosis inhibitor 5 (API5), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.