DACH2 (NM_001139515) Human Mass Spec Standard

SKU
PH327811
DACH2 MS Standard C13 and N15-labeled recombinant protein (NP_001132987)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227811]
Predicted MW 47 kDa
Protein Sequence
Protein Sequence
>RC227811 representing NM_001139515
Red=Cloning site Green=Tags(s)

MTRKQAVNSSRPGRPPKRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTL
QGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHL
LTNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMAAAAQIHSPLSRAGTSVIKERIPESPSP
APSLEENHRPGSQTSSHTSSSVSSSPSQMDHHLERMEEVPVQIPIMKSPLDKIQLTPGQALPAGFPGPFI
FADSLSSVETLLTNIQGLLKVALDNARIQEKQIQQEKKELRLELYREREIRENLERQLAVELQSRTTMQK
RLKKEKKTKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNY
YCLEMAQQLYSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001132987
RefSeq ORF 1296
Locus ID 117154
UniProt ID Q96NX9
Cytogenetics Xq21.2
Summary This gene is one of two genes which encode a protein similar to the Drosophila protein dachshund, a transcription factor involved in cell fate determination in the eye, limb and genital disc of the fly. The encoded protein contains two characteristic dachshund domains: an N-terminal domain responsible for DNA binding and a C-terminal domain responsible for protein-protein interactions. This gene is located on the X chromosome and is subject to inactivation by DNA methylation. The encoded protein may be involved in regulation of organogenesis and myogenesis, and may play a role in premature ovarian failure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:DACH2 (NM_001139515) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409299 DACH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427975 DACH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427976 DACH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409299 Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 1 100 ug
$665.00
LY427975 Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 2 100 ug
$436.00
LY427976 Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3 100 ug
$436.00
TP327811 Recombinant protein of human dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.