Transcription Factor SP9 (SP9) (NM_001145250) Human Mass Spec Standard

SKU
PH327808
SP9 MS Standard C13 and N15-labeled recombinant protein (NP_001138722)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227808]
Predicted MW 48.7 kDa
Protein Sequence
Protein Sequence
>RC227808 representing NM_001145250
Red=Cloning site Green=Tags(s)

MATSILGEEPRFGTTPLAMLAATCNKIGNTSPLTTLPESSAFAKGGFHPWKRSSSSCNLGSSLSGFAVAT
GGRGSGGLAGGSGAANSAFCLASTSPTSSAFSSDYGGLFSNSAAAAAAAAGVSPQEAGGQSAFISKVHTT
AADGLYPRVGMAHPYESWYKSGFHSTLAAGEVTNGAASSWWDVHSSPGSWLEVQNPAGGLQSSLHSGAPQ
ASLHSQLGTYNPDFSSLTHSAFSSTGLGSSAAAASHLLSTSQHLLAQDGFKPVLPSYSDSSAAVAAAAAS
AMISGAAAAAAGGSSARSARRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLK
AHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIKTHNGGGGG
KKGSDSDTDASNLETPRSESPDLILHDSGVSAARAAAAAAAAAAAAAAAASAGGKEAASGPNDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138722
RefSeq ORF 1452
Synonyms ZNF990
Locus ID 100131390
UniProt ID P0CG40
Cytogenetics 2q31.1
Summary Transcription factor which plays a key role in limb development. Positively regulates FGF8 expression in the apical ectodermal ridge (AER) and contributes to limb outgrowth in embryos (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Transcription Factor SP9 (SP9) (NM_001145250) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC428761 SP9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY428761 Transient overexpression lysate of Sp9 transcription factor homolog (mouse) (SP9) 100 ug
$436.00
TP327808 Purified recombinant protein of Homo sapiens Sp9 transcription factor homolog (mouse) (SP9), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.