ANTXR2 (NM_001145794) Human Mass Spec Standard

SKU
PH327771
ANTXR2 MS Standard C13 and N15-labeled recombinant protein (NP_001139266)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227771]
Predicted MW 53.5 kDa
Protein Sequence
Protein Sequence
>RC227771 representing NM_001145794
Red=Cloning site Green=Tags(s)

MVAERSPARSPGSWLFPGLWLLVLSGPGGLLRAQEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLA
ERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTS
SIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGII
NSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCP
APILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIK
DPPPPPAPAPKEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPE
ETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEVCIWECIEKELTA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139266
RefSeq ORF 1467
Synonyms CMG-2; CMG2; HFS; ISH; JHF
Locus ID 118429
UniProt ID P58335
Cytogenetics 4q21.21
Summary This gene encodes a receptor for anthrax toxin. The protein binds to collagen IV and laminin, suggesting that it may be involved in extracellular matrix adhesion. Mutations in this gene cause juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:ANTXR2 (NM_001145794) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318589 ANTXR2 MS Standard C13 and N15-labeled recombinant protein (NP_477520) 10 ug
$3,255.00
LC403300 ANTXR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403300 Transient overexpression lysate of anthrax toxin receptor 2 (ANTXR2), transcript variant 1 100 ug
$665.00
TP318589 Recombinant protein of human anthrax toxin receptor 2 (ANTXR2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327771 Recombinant protein of human anthrax toxin receptor 2 (ANTXR2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.