MyoGEF (PLEKHG6) (NM_001144857) Human Mass Spec Standard

SKU
PH327365
PLEKHG6 MS Standard C13 and N15-labeled recombinant protein (NP_001138329)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227365]
Predicted MW 85.3 kDa
Protein Sequence
Protein Sequence
>RC227365 representing NM_001144857
Red=Cloning site Green=Tags(s)

MGCRLHAPGEKAAHDPSRRRLQQYVPFARGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKELTK
AHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLTIEKSWRELVPGHKEMSQELCHQQEALWELLTT
ELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLD
PIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQR
ITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDE
VEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKADKAKVI
RPPLMLEKLVCQPLRDPNSFLLIHLTEFQCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQ
KRELLTLYRDQDRESPSTRPSTPSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPLVPDDTSDSGYGT
LIPGTPTGSRSPLSRLRQRALRRDPRLTFSTLELRDIPLRPHPPDPQAPQRRSAPELPEGILKGGSLPQE
DPPTWSEEEDGASERGNVVVETLHRARLRGQLPSSPTHADSAGESPWESSGEEEEEGPLFLKAGHTSLRP
MRAEDMLREIREELASQRIEGAEEPRDSRPRKLTRAQLQRMRGPHIIQLDTPLSASEV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138329
RefSeq ORF 2274
Synonyms MyoGEF
Locus ID 55200
UniProt ID Q3KR16
Cytogenetics 12p13.31
Summary Guanine nucleotide exchange factor activating the small GTPase RHOA, which, in turn, induces myosin filament formation. Also activates RHOG. Does not activate RAC1, or to a much lower extent than RHOA and RHOG. Part of a functional unit, involving PLEKHG6, MYH10 and RHOA, at the cleavage furrow to advance furrow ingression during cytokinesis. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with EZR, required for normal macropinocytosis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MyoGEF (PLEKHG6) (NM_001144857) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413270 PLEKHG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428528 PLEKHG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428529 PLEKHG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413270 Transient overexpression lysate of pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 1 100 ug
$665.00
LY428528 Transient overexpression lysate of pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 2 100 ug
$665.00
LY428529 Transient overexpression lysate of pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 3 100 ug
$665.00
TP327365 Recombinant protein of human pleckstrin homology domain containing, family G (with RhoGef domain) member 6 (PLEKHG6), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.