RAB11FIP3 (NM_001142272) Human Mass Spec Standard

SKU
PH327246
RAB11FIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001135744)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227246]
Predicted MW 52.3 kDa
Protein Sequence
Protein Sequence
>RC227246 representing NM_001142272
Red=Cloning site Green=Tags(s)

MPFLKANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGAL
LLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKVARYL
HQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEE
QLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEK
QKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRS
SSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVS
RDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135744
RefSeq ORF 1380
Synonyms CART1; FIP3-Rab11; Rab11-FIP3
Locus ID 9727
UniProt ID O75154
Cytogenetics 16p13.3
Summary Proteins of the large Rab GTPase family (see RAB1A; MIM 179508) have regulatory roles in the formation, targeting, and fusion of intracellular transport vesicles. RAB11FIP3 is one of many proteins that interact with and regulate Rab GTPases (Hales et al., 2001 [PubMed 11495908]).[supplied by OMIM, Mar 2008]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:RAB11FIP3 (NM_001142272) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC427996 RAB11FIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY427996 Transient overexpression lysate of RAB11 family interacting protein 3 (class II) (RAB11FIP3), transcript variant 2 100 ug
$436.00
TP327246 Purified recombinant protein of Homo sapiens RAB11 family interacting protein 3 (class II) (RAB11FIP3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.