Poliovirus Receptor (PVR) (NM_001135769) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC227222] |
Predicted MW | 39.1 kDa |
Protein Sequence |
Protein Sequence
>RC227222 representing NM_001135769
Red=Cloning site Green=Tags(s) MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG ESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLR VLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVP SSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWS TTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKGTEHASASANGHVSYSAVSR ENSSSQDPQTEGTR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001129241 |
RefSeq ORF | 1092 |
Synonyms | CD155; HVED; Necl-5; NECL5; PVS; TAGE4 |
Locus ID | 5817 |
UniProt ID | P15151 |
Cytogenetics | 19q13.31 |
Summary | The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC401951 | PVR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427700 | PVR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427701 | PVR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401951 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 1 | 100 ug |
$436.00
|
|
LY427700 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 2 | 100 ug |
$436.00
|
|
LY427701 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 3 | 100 ug |
$436.00
|
|
TP327222 | Purified recombinant protein of Homo sapiens poliovirus receptor (PVR), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP720486 | Recombinant protein of human poliovirus receptor (PVR), transcript variant 2 | 10 ug |
$265.00
|
|
TP723950 | Human CD155 Protein, mFc-His tag | 100 ug |
$620.00
|
|
TP724018 | Human CD155 Protein, hFc tag | 100 ug |
$650.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.