Poliovirus Receptor (PVR) (NM_001135769) Human Mass Spec Standard

SKU
PH327222
PVR MS Standard C13 and N15-labeled recombinant protein (NP_001129241)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227222]
Predicted MW 39.1 kDa
Protein Sequence
Protein Sequence
>RC227222 representing NM_001135769
Red=Cloning site Green=Tags(s)

MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG
ESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLR
VLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVP
SSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWS
TTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKGTEHASASANGHVSYSAVSR
ENSSSQDPQTEGTR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129241
RefSeq ORF 1092
Synonyms CD155; HVED; Necl-5; NECL5; PVS; TAGE4
Locus ID 5817
UniProt ID P15151
Cytogenetics 19q13.31
Summary The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
Write Your Own Review
You're reviewing:Poliovirus Receptor (PVR) (NM_001135769) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401951 PVR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427700 PVR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427701 PVR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401951 Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 1 100 ug
$436.00
LY427700 Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 2 100 ug
$436.00
LY427701 Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 3 100 ug
$436.00
TP327222 Purified recombinant protein of Homo sapiens poliovirus receptor (PVR), transcript variant 3, 20 µg 20 ug
$737.00
TP720486 Recombinant protein of human poliovirus receptor (PVR), transcript variant 2 10 ug
$265.00
TP723950 Human CD155 Protein, mFc-His tag 100 ug
$620.00
TP724018 Human CD155 Protein, hFc tag 100 ug
$650.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.