RAD54 (RAD54L) (NM_001142548) Human Mass Spec Standard

SKU
PH327119
RAD54L MS Standard C13 and N15-labeled recombinant protein (NP_001136020)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227119]
Predicted MW 84.4 kDa
Protein Sequence
Protein Sequence
>RC227119 protein sequence
Red=Cloning site Green=Tags(s)

MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQH
EAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLP
VHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPE
IDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRL
HVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTA
HEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKAL
EPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN
SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEK
IFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCT
SDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001136020
RefSeq Size 2567
RefSeq ORF 2241
Synonyms hHR54; HR54; hRAD54; RAD54A
Locus ID 8438
UniProt ID Q92698
Cytogenetics 1p34.1
Summary The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Dec 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Homologous recombination
Write Your Own Review
You're reviewing:RAD54 (RAD54L) (NM_001142548) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320046 RAD54L MS Standard C13 and N15-labeled recombinant protein (NP_003570) 10 ug
$3,255.00
LC418575 RAD54L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428166 RAD54L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418575 Transient overexpression lysate of RAD54-like (S. cerevisiae) (RAD54L), transcript variant 1 100 ug
$665.00
LY428166 Transient overexpression lysate of RAD54-like (S. cerevisiae) (RAD54L), transcript variant 2 100 ug
$665.00
TP320046 Recombinant protein of human RAD54-like (S. cerevisiae) (RAD54L), transcript variant 1, 20 µg 20 ug
$737.00
TP327119 Recombinant protein of human RAD54-like (S. cerevisiae) (RAD54L), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.