Parvin gamma (PARVG) (NM_001137605) Human Mass Spec Standard

SKU
PH326988
PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131077)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226988]
Predicted MW 37.5 kDa
Protein Sequence
Protein Sequence
>RC226988 protein sequence
Red=Cloning site Green=Tags(s)

MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEE
DMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTL
HLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVN
AVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALE
LLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001131077
RefSeq Size 3475
RefSeq ORF 993
Locus ID 64098
UniProt ID Q9HBI0
Cytogenetics 22q13.31
Summary Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM, Aug 2004]
Protein Pathways Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis
Write Your Own Review
You're reviewing:Parvin gamma (PARVG) (NM_001137605) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306755 PARVG MS Standard C13 and N15-labeled recombinant protein (NP_071424) 10 ug
$3,255.00
PH327051 PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131078) 10 ug
$3,255.00
LC411746 PARVG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427944 PARVG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427945 PARVG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411746 Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 1 100 ug
$436.00
LY427944 Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 2 100 ug
$436.00
LY427945 Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 3 100 ug
$436.00
TP306755 Recombinant protein of human parvin, gamma (PARVG), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326988 Recombinant protein of human parvin, gamma (PARVG), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327051 Recombinant protein of human parvin, gamma (PARVG), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.