Parvin gamma (PARVG) (NM_001137605) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226988] |
Predicted MW | 37.5 kDa |
Protein Sequence |
Protein Sequence
>RC226988 protein sequence
Red=Cloning site Green=Tags(s) MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEE DMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTL HLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVN AVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALE LLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001131077 |
RefSeq Size | 3475 |
RefSeq ORF | 993 |
Locus ID | 64098 |
UniProt ID | Q9HBI0 |
Cytogenetics | 22q13.31 |
Summary | Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM, Aug 2004] |
Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306755 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_071424) | 10 ug |
$3,255.00
|
|
PH327051 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131078) | 10 ug |
$3,255.00
|
|
LC411746 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427944 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427945 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY411746 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 1 | 100 ug |
$436.00
|
|
LY427944 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 2 | 100 ug |
$436.00
|
|
LY427945 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 3 | 100 ug |
$436.00
|
|
TP306755 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP326988 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP327051 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.