ICA1 (NM_001136020) Human Mass Spec Standard

SKU
PH326813
ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001129492)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226813]
Predicted MW 54.5 kDa
Protein Sequence
Protein Sequence
>RC226813 representing NM_001136020
Red=Cloning site Green=Tags(s)

MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCL
DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV
ETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMD
VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKE
EKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSE
EGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQT
GSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129492
RefSeq ORF 1446
Synonyms ICA69; ICAp69
Locus ID 3382
UniProt ID Q05084
Cytogenetics 7p21.3
Summary This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]
Protein Pathways Type I diabetes mellitus
Write Your Own Review
You're reviewing:ICA1 (NM_001136020) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302149 ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_004959) 10 ug
$3,255.00
LC402921 ICA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417620 ICA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427769 ICA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402921 Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1 100 ug
$436.00
LY417620 Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2 100 ug
$436.00
LY427769 Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1) 100 ug
$436.00
TP302149 Recombinant protein of human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 20 µg 20 ug
$737.00
TP326813 Purified recombinant protein of Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.