FLYWCH2 (NM_001142500) Human Mass Spec Standard

SKU
PH326791
FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135972)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226791]
Predicted MW 14.6 kDa
Protein Sequence
Protein Sequence
>RC226791 protein sequence
Red=Cloning site Green=Tags(s)

MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGV
PGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135972
RefSeq Size 1040
RefSeq ORF 420
Locus ID 114984
UniProt ID Q96CP2
Cytogenetics 16p13.3
Write Your Own Review
You're reviewing:FLYWCH2 (NM_001142500) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304275 FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_612448) 10 ug
$3,255.00
PH326732 FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135971) 10 ug
$3,255.00
LC408693 FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428133 FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428134 FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408693 Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 1 100 ug
$436.00
LY428133 Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 2 100 ug
$436.00
LY428134 Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 3 100 ug
$436.00
TP304275 Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 1, 20 µg 20 ug
$867.00
TP326732 Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 2, 20 µg 20 ug
$867.00
TP326791 Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.