SIRPB1 (NM_001135844) Human Mass Spec Standard

SKU
PH326750
SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129316)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226750]
Predicted MW 43.2 kDa
Protein Sequence
Protein Sequence
>RC226750 representing NM_001135844
Red=Cloning site Green=Tags(s)

MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLCCAMTSLIPVGPIMWFRG
AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE
LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS
TARVVLTRGDVHSQVICEMAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR
GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA
HQKEHGSDITHEPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129316
RefSeq ORF 1194
Synonyms CD172b; SIRP-BETA-1
Locus ID 10326
UniProt ID Q5TFQ8
Cytogenetics 20p13
Summary The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:SIRPB1 (NM_001135844) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311765 SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_006056) 10 ug
$3,255.00
LC416898 SIRPB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427721 SIRPB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416898 Transient overexpression lysate of signal-regulatory protein beta 1 (SIRPB1), transcript variant 1 100 ug
$436.00
LY427721 Transient overexpression lysate of signal-regulatory protein beta 1 (SIRPB1), transcript variant 3 100 ug
$436.00
TP311765 Recombinant protein of human signal-regulatory protein beta 1 (SIRPB1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326750 Purified recombinant protein of Homo sapiens signal-regulatory protein beta 1 (SIRPB1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.