GDNF Receptor alpha 1 (GFRA1) (NM_001145453) Human Mass Spec Standard

SKU
PH326704
GFRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001138925)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226704]
Predicted MW 50.84 kDa
Protein Sequence
Protein Sequence
>RC226704 representing NM_001145453
Red=Cloning site Green=Tags(s)

MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKD
ECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISV
EHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCS
CRDIACTERRRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADC
LLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQ
PAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNYEKEGL
GASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLSLTETS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138925
RefSeq ORF 1380
Synonyms GDNFR; GDNFRA; GFR-ALPHA-1; GFRalpha-1; RET1L; RETL1; TRNR1
Locus ID 2674
UniProt ID P56159
Cytogenetics 10q25.3
Summary This gene encodes a member of the glial cell line-derived neurotrophic factor receptor (GDNFR) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature receptor. Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. This receptor is a glycosylphosphatidylinositol (GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:GDNF Receptor alpha 1 (GFRA1) (NM_001145453) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407880 GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417417 GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428898 GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407880 Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 2 100 ug
$436.00
LY417417 Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 1 100 ug
$665.00
LY428898 Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 3 100 ug
$436.00
TP326704 Recombinant protein of human GDNF family receptor alpha 1 (GFRA1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720395 Recombinant protein of human GDNF family receptor alpha 1 (GFRA1), transcript variant 3 10 ug
$170.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.