SPATA24 (NM_194296) Human Mass Spec Standard

SKU
PH326669
SPATA24 MS Standard C13 and N15-labeled recombinant protein (NP_919272)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226669]
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC226669 representing NM_194296
Red=Cloning site Green=Tags(s)

MATPLGWSKAGSGSVCLALDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKT
KVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLITKCNEIESHIIKQEDI
LNGKENEIKELQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQHPREK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_919272
RefSeq ORF 615
Synonyms CCDC161; T6441
Locus ID 202051
UniProt ID Q86W54
Cytogenetics 5q31.2
Summary Binds DNA with high affinity but does not bind to TATA boxes. Synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter. May play a role in cytoplasm movement and removal during spermiogenesis (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SPATA24 (NM_194296) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC430677 SPATA24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY430677 Transient overexpression lysate of spermatogenesis associated 24 (SPATA24) 100 ug
$436.00
TP326669 Recombinant protein of human hypothetical protein LOC202051 (LOC202051), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.