TSH Receptor (TSHR) (NM_001142626) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226653] |
Predicted MW | 30.8 kDa |
Protein Sequence |
Protein Sequence
>RC226653 representing NM_001142626
Red=Cloning site Green=Tags(s) MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN KYLTVIDKDAFGGVYSGPSLLVENVAVSGKGFCKSLFSWLYRLPLGRKSLSFETQKAPRSSMPS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001136098 |
RefSeq ORF | 822 |
Synonyms | CHNG1; hTSHR-I; LGR3 |
Locus ID | 7253 |
UniProt ID | P16473 |
Cytogenetics | 14q31.1 |
Summary | The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Autoimmune thyroid disease, Neuroactive ligand-receptor interaction |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400133 | TSHR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400133 | Transient overexpression lysate of thyroid stimulating hormone receptor (TSHR), transcript variant 1 | 100 ug |
$665.00
|
|
TP326653 | Purified recombinant protein of Homo sapiens thyroid stimulating hormone receptor (TSHR), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP701226 | Purified recombinant protein of Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, Met22-Gly413, with C-terminal Human FC-AVI plus and His tag, expressed in CHO cells, 50ug | 50 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.