SYT2 (NM_001136504) Human Mass Spec Standard

SKU
PH326544
SYT2 MS Standard C13 and N15-labeled recombinant protein (NP_001129976)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226544]
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC226544 protein sequence
Red=Cloning site Green=Tags(s)

MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAV
VAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENL
GKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTF
KVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRY
VPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQI
QKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129976
RefSeq Size 7614
RefSeq ORF 1257
Synonyms CMS7; MYSPC; SytII
Locus ID 127833
UniProt ID Q8N9I0
Cytogenetics 1q32.1
Summary This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. Mutations in this gene are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:SYT2 (NM_001136504) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406152 SYT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427901 SYT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406152 Transient overexpression lysate of synaptotagmin II (SYT2), transcript variant 1 100 ug
$665.00
LY427901 Transient overexpression lysate of synaptotagmin II (SYT2), transcript variant 2 100 ug
$436.00
TP326544 Recombinant protein of human synaptotagmin II (SYT2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.