RAB34 (NM_001144943) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226508] |
Predicted MW | 35 kDa |
Protein Sequence |
Protein Sequence
>RC226508 representing NM_001144943
Red=Cloning site Green=Tags(s) MSHLPGLELRREAPPLLGPLLSPFPLPAGSWHRQMLRSSLRFPITNSAGAPCKAAGRMNILAPVRRDRVL AELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKA TIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKE NDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLA ELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001138415 |
RefSeq ORF | 948 |
Synonyms | NARR; RAB39; RAH |
Locus ID | 83871 |
UniProt ID | B4DNC0 |
Cytogenetics | 17q11.2 |
Summary | This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309722 | RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_114140) | 10 ug |
$3,255.00
|
|
LC403132 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428219 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428594 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428595 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403132 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 1 | 100 ug |
$436.00
|
|
LY428219 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 3 | 100 ug |
$436.00
|
|
LY428594 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 5 | 100 ug |
$436.00
|
|
LY428595 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 8 | 100 ug |
$436.00
|
|
TP309722 | Recombinant protein of human RAB34, member RAS oncogene family (RAB34), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP326508 | Purified recombinant protein of Homo sapiens RAB34, member RAS oncogene family (RAB34), transcript variant 8, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.