RAB34 (NM_001144943) Human Mass Spec Standard

SKU
PH326508
RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_001138415)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226508]
Predicted MW 35 kDa
Protein Sequence
Protein Sequence
>RC226508 representing NM_001144943
Red=Cloning site Green=Tags(s)

MSHLPGLELRREAPPLLGPLLSPFPLPAGSWHRQMLRSSLRFPITNSAGAPCKAAGRMNILAPVRRDRVL
AELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKA
TIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKE
NDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLA
ELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138415
RefSeq ORF 948
Synonyms NARR; RAB39; RAH
Locus ID 83871
UniProt ID B4DNC0
Cytogenetics 17q11.2
Summary This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame. [provided by RefSeq, Dec 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB34 (NM_001144943) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309722 RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_114140) 10 ug
$3,255.00
LC403132 RAB34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428219 RAB34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428594 RAB34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428595 RAB34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403132 Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 1 100 ug
$436.00
LY428219 Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 3 100 ug
$436.00
LY428594 Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 5 100 ug
$436.00
LY428595 Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 8 100 ug
$436.00
TP309722 Recombinant protein of human RAB34, member RAS oncogene family (RAB34), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326508 Purified recombinant protein of Homo sapiens RAB34, member RAS oncogene family (RAB34), transcript variant 8, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.