GRIA1 (NM_001114183) Human Mass Spec Standard

SKU
PH326253
GRIA1 MS Standard C13 and N15-labeled recombinant protein (NP_001107655)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226253]
Predicted MW 101.3 kDa
Protein Sequence
Protein Sequence
>RC226253 representing NM_001114183
Red=Cloning site Green=Tags(s)

MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEM
TYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHY
KWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLN
AILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTR
VDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLT
GNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAV
APLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF
SPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSY
TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTT
EEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQ
GVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001107655
RefSeq ORF 2718
Synonyms GluA1; GLUH1; GLUR1; GLURA; HBGR1
Locus ID 2890
UniProt ID P42261
Cytogenetics 5q33.2
Summary Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Ion Channels: Glutamate Receptors, Transmembrane
Protein Pathways Amyotrophic lateral sclerosis (ALS), Long-term depression, Long-term potentiation, Neuroactive ligand-receptor interaction
Write Your Own Review
You're reviewing:GRIA1 (NM_001114183) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400293 GRIA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426474 GRIA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400293 Transient overexpression lysate of glutamate receptor, ionotropic, AMPA 1 (GRIA1), transcript variant 1 100 ug
$665.00
LY426474 Transient overexpression lysate of glutamate receptor, ionotropic, AMPA 1 (GRIA1), transcript variant 2 100 ug
$665.00
TP326253 Recombinant protein of human glutamate receptor, ionotropic, AMPA 1 (GRIA1), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.