ARHGEF7 (NM_001113513) Human Mass Spec Standard

SKU
PH326057
ARHGEF7 MS Standard C13 and N15-labeled recombinant protein (NP_001106985)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226057]
Predicted MW 73 kDa
Protein Sequence
Protein Sequence
>RC226057 representing NM_001113513
Red=Cloning site Green=Tags(s)

MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPV
SPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGN
LEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMET
KGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELE
LQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPT
TGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLP
SHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALC
YKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKES
APQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVR
KVLKNMNDPAWDETNL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001106985
RefSeq ORF 1938
Synonyms BETA-PIX; COOL-1; COOL1; Nbla10314; P50; P50BP; P85; P85COOL1; P85SPR; PAK3; PIXB
Locus ID 8874
UniProt ID Q14155
Cytogenetics 13q34
Summary This gene encodes a protein that belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Mar 2016]
Protein Pathways Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:ARHGEF7 (NM_001113513) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318798 ARHGEF7 MS Standard C13 and N15-labeled recombinant protein (NP_663788) 10 ug
$3,255.00
LC407867 ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418366 ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426426 ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407867 Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 2 100 ug
$665.00
LY418366 Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 1 100 ug
$665.00
LY426426 Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 5 100 ug
$436.00
TP318798 Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326057 Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.