Ezrin (EZR) (NM_001111077) Human Mass Spec Standard
CAT#: PH325989
EZR MS Standard C13 and N15-labeled recombinant protein (NP_001104547)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225989 |
Predicted MW | 69.4 kDa |
Protein Sequence |
>RC225989 protein sequence
Red=Cloning site Green=Tags(s) MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ GRDKYKTLRQIRQGNTKQRIDEFEAL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001104547 |
RefSeq Size | 3138 |
RefSeq ORF | 1758 |
Synonyms | CVIL; CVL; HEL-S-105; VIL2 |
Locus ID | 7430 |
UniProt ID | P15311 |
Cytogenetics | 6q25.3 |
Summary | The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401164 | EZR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426350 | EZR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401164 | Transient overexpression lysate of ezrin (EZR), transcript variant 1 |
USD 436.00 |
|
LY426350 | Transient overexpression lysate of ezrin (EZR), transcript variant 2 |
USD 436.00 |
|
PH300404 | EZR MS Standard C13 and N15-labeled recombinant protein (NP_003370) |
USD 3,255.00 |
|
TP300404 | Recombinant protein of human ezrin (EZR), transcript variant 1, 20 µg |
USD 867.00 |
|
TP325989 | Recombinant protein of human ezrin (EZR), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review