Ezrin (EZR) (NM_001111077) Human Mass Spec Standard

SKU
PH325989
EZR MS Standard C13 and N15-labeled recombinant protein (NP_001104547)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225989]
Predicted MW 69.4 kDa
Protein Sequence
Protein Sequence
>RC225989 protein sequence
Red=Cloning site Green=Tags(s)

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV
RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE
VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN
KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI
LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ
DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ
GRDKYKTLRQIRQGNTKQRIDEFEAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001104547
RefSeq Size 3138
RefSeq ORF 1758
Synonyms CVIL; CVL; HEL-S-105; VIL2
Locus ID 7430
UniProt ID P15311
Cytogenetics 6q25.3
Summary The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:Ezrin (EZR) (NM_001111077) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300404 EZR MS Standard C13 and N15-labeled recombinant protein (NP_003370) 10 ug
$3,255.00
LC401164 EZR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426350 EZR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401164 Transient overexpression lysate of ezrin (EZR), transcript variant 1 100 ug
$436.00
LY426350 Transient overexpression lysate of ezrin (EZR), transcript variant 2 100 ug
$436.00
TP300404 Recombinant protein of human ezrin (EZR), transcript variant 1, 20 µg 20 ug
$867.00
TP325989 Recombinant protein of human ezrin (EZR), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.