Ezrin (EZR) (NM_001111077) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC225989] |
Predicted MW | 69.4 kDa |
Protein Sequence |
Protein Sequence
>RC225989 protein sequence
Red=Cloning site Green=Tags(s) MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ GRDKYKTLRQIRQGNTKQRIDEFEAL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001104547 |
RefSeq Size | 3138 |
RefSeq ORF | 1758 |
Synonyms | CVIL; CVL; HEL-S-105; VIL2 |
Locus ID | 7430 |
UniProt ID | P15311 |
Cytogenetics | 6q25.3 |
Summary | The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300404 | EZR MS Standard C13 and N15-labeled recombinant protein (NP_003370) | 10 ug |
$3,255.00
|
|
LC401164 | EZR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426350 | EZR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401164 | Transient overexpression lysate of ezrin (EZR), transcript variant 1 | 100 ug |
$436.00
|
|
LY426350 | Transient overexpression lysate of ezrin (EZR), transcript variant 2 | 100 ug |
$436.00
|
|
TP300404 | Recombinant protein of human ezrin (EZR), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP325989 | Recombinant protein of human ezrin (EZR), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.