SH3BP2 (NM_001122681) Human Mass Spec Standard

SKU
PH325960
SH3BP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116153)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225960]
Predicted MW 62.2 kDa
Protein Sequence
Protein Sequence
>RC225960 protein sequence
Red=Cloning site Green=Tags(s)

MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYYFKSSTSASPQ
GAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKSWMALLRREIGHFHEKKDLPL
DTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDDSYLEPDSPEPGRLEDALMHPPAYPPPPVP
TPRKPAFSDMPRAHSFTSKGPGPLLPPPPPKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDP
PLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPP
PVPANKPKFLKIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDG
QSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNS
STKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGP
R

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001116153
RefSeq Size 9068
RefSeq ORF 1683
Synonyms 3BP-2; 3BP2; CRBM; CRPM; RES4-23
Locus ID 6452
UniProt ID P78314
Cytogenetics 4p16.3
Summary The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Protein Families Druggable Genome
Protein Pathways Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:SH3BP2 (NM_001122681) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305759 SH3BP2 MS Standard C13 and N15-labeled recombinant protein (NP_003014) 10 ug
$3,255.00
LC401057 SH3BP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426549 SH3BP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401057 Transient overexpression lysate of SH3-domain binding protein 2 (SH3BP2), transcript variant 1 100 ug
$436.00
LY426549 Transient overexpression lysate of SH3-domain binding protein 2 (SH3BP2), transcript variant 2 100 ug
$436.00
TP305759 Recombinant protein of human SH3-domain binding protein 2 (SH3BP2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325960 Recombinant protein of human SH3-domain binding protein 2 (SH3BP2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.