LSM14A (NM_001114093) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC225784] |
Predicted MW | 50.6 kDa |
Protein Sequence |
Protein Sequence
>RC225784 protein sequence
Red=Cloning site Green=Tags(s) MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGS DIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAG SSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPA AVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRG RFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGN ADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGG RGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001107565 |
RefSeq Size | 3772 |
RefSeq ORF | 1389 |
Synonyms | C19orf13; FAM61A; RAP55; RAP55A |
Locus ID | 26065 |
UniProt ID | Q8ND56 |
Cytogenetics | 19q13.11 |
Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Mar 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302352 | LSM14A MS Standard C13 and N15-labeled recombinant protein (NP_056393) | 10 ug |
$3,255.00
|
|
LC414433 | LSM14A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426447 | LSM14A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY414433 | Transient overexpression lysate of LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2 | 100 ug |
$436.00
|
|
LY426447 | Transient overexpression lysate of LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 1 | 100 ug |
$436.00
|
|
TP302352 | Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP325784 | Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.