LSM14A (NM_001114093) Human Mass Spec Standard

SKU
PH325784
LSM14A MS Standard C13 and N15-labeled recombinant protein (NP_001107565)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225784]
Predicted MW 50.6 kDa
Protein Sequence
Protein Sequence
>RC225784 protein sequence
Red=Cloning site Green=Tags(s)

MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGS
DIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAG
SSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPA
AVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRG
RFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGN
ADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGG
RGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001107565
RefSeq Size 3772
RefSeq ORF 1389
Synonyms C19orf13; FAM61A; RAP55; RAP55A
Locus ID 26065
UniProt ID Q8ND56
Cytogenetics 19q13.11
Summary Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:LSM14A (NM_001114093) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302352 LSM14A MS Standard C13 and N15-labeled recombinant protein (NP_056393) 10 ug
$3,255.00
LC414433 LSM14A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426447 LSM14A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414433 Transient overexpression lysate of LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2 100 ug
$436.00
LY426447 Transient overexpression lysate of LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 1 100 ug
$436.00
TP302352 Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2, 20 µg 20 ug
$867.00
TP325784 Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.