TACC1 (NM_001122824) Human Mass Spec Standard

SKU
PH325610
TACC1 MS Standard C13 and N15-labeled recombinant protein (NP_001116296)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225610]
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC225610 representing NM_001122824
Red=Cloning site Green=Tags(s)

MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFRSGCKVKKHETQSLALD
ACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSS
SEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIE
ANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSD
LFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESA
ALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001116296
RefSeq ORF 1185
Synonyms Ga55
Locus ID 6867
UniProt ID O75410
Cytogenetics 8p11.22
Summary This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]
Write Your Own Review
You're reviewing:TACC1 (NM_001122824) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC426566 TACC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431527 TACC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY426566 Transient overexpression lysate of transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 2 100 ug
$436.00
LY431527 Transient overexpression lysate of transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 3 100 ug
$436.00
TP325610 Recombinant protein of human transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.