MSF (SEPT9) (NM_001113496) Human Mass Spec Standard

SKU
PH325490
SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_001106968)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225490]
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC225490 representing NM_001113496
Red=Cloning site Green=Tags(s)

MADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKS
KISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYL
QEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRI
TADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHC
EFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001106968
RefSeq ORF 1005
Synonyms AF17q25; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SINT1
Locus ID 10801
UniProt ID Q9UHD8
Cytogenetics 17q25.3
Summary This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:MSF (SEPT9) (NM_001113496) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300264 SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_006631) 10 ug
$3,255.00
LC401986 42256 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426417 42256 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426419 42256 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426421 42256 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426422 42256 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401986 Transient overexpression lysate of septin 9 (SEPT9), transcript variant 3 100 ug
$436.00
LY426417 Transient overexpression lysate of septin 9 (SEPT9), transcript variant 1 100 ug
$436.00
LY426419 Transient overexpression lysate of septin 9 (SEPT9), transcript variant 2 100 ug
$436.00
LY426421 Transient overexpression lysate of septin 9 (SEPT9), transcript variant 4 100 ug
$436.00
LY426422 Transient overexpression lysate of septin 9 (SEPT9), transcript variant 7 100 ug
$436.00
TP300264 Recombinant protein of human septin 9 (SEPT9), transcript variant 3, 20 µg 20 ug
$737.00
TP325490 Purified recombinant protein of Homo sapiens septin 9 (SEPT9), transcript variant 7, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.