MSF (SEPT9) (NM_001113496) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC225490] |
Predicted MW | 38.3 kDa |
Protein Sequence |
Protein Sequence
>RC225490 representing NM_001113496
Red=Cloning site Green=Tags(s) MADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKS KISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYL QEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRI TADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHC EFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001106968 |
RefSeq ORF | 1005 |
Synonyms | AF17q25; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SINT1 |
Locus ID | 10801 |
UniProt ID | Q9UHD8 |
Cytogenetics | 17q25.3 |
Summary | This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300264 | SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_006631) | 10 ug |
$3,255.00
|
|
LC401986 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426417 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426419 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426421 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426422 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401986 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 3 | 100 ug |
$436.00
|
|
LY426417 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 1 | 100 ug |
$436.00
|
|
LY426419 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 2 | 100 ug |
$436.00
|
|
LY426421 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 4 | 100 ug |
$436.00
|
|
LY426422 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 7 | 100 ug |
$436.00
|
|
TP300264 | Recombinant protein of human septin 9 (SEPT9), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP325490 | Purified recombinant protein of Homo sapiens septin 9 (SEPT9), transcript variant 7, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.