ABIN3 (TNIP3) (NM_001128843) Human Mass Spec Standard

SKU
PH325469
TNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001122315)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225469]
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC225469 protein sequence
Red=Cloning site Green=Tags(s)

MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYER
KVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRHRDLTRDRLQREEKEKERLNEELHELKEENKL
LKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEED
FKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPW
VPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001122315
RefSeq Size 2410
RefSeq ORF 975
Synonyms ABIN-3; LIND
Locus ID 79931
UniProt ID Q96KP6
Cytogenetics 4q27
Summary Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ABIN3 (TNIP3) (NM_001128843) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403041 TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427001 TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403041 Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 1 100 ug
$436.00
LY427001 Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2 100 ug
$436.00
TP325469 Purified recombinant protein of Homo sapiens TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.