THTPA (NM_001126339) Human Mass Spec Standard

SKU
PH325287
THTPA MS Standard C13 and N15-labeled recombinant protein (NP_001119811)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225287]
Predicted MW 25.6 kDa
Protein Sequence
Protein Sequence
>RC225287 protein sequence
Red=Cloning site Green=Tags(s)

MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA
GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP
QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL
EVNSSRERPQETEDPDHCLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001119811
RefSeq Size 1829
RefSeq ORF 690
Synonyms THTP; THTPASE
Locus ID 79178
UniProt ID Q9BU02
Cytogenetics 14q11.2
Summary This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]
Protein Pathways Metabolic pathways, Thiamine metabolism
Write Your Own Review
You're reviewing:THTPA (NM_001126339) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300849 THTPA MS Standard C13 and N15-labeled recombinant protein (NP_077304) 10 ug
$3,255.00
LC411308 THTPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426679 THTPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411308 Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 1 100 ug
$436.00
LY426679 Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 2 100 ug
$436.00
TP300849 Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325287 Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.