HP1 alpha (CBX5) (NM_001127321) Human Mass Spec Standard

SKU
PH325208
CBX5 MS Standard C13 and N15-labeled recombinant protein (NP_001120793)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225208]
Predicted MW 22.2 kDa
Protein Sequence
Protein Sequence
>RC225208 protein sequence
Red=Cloning site Green=Tags(s)

MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKY
KKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLM
KWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001120793
RefSeq Size 11525
RefSeq ORF 573
Synonyms HEL25; HP1; HP1A
Locus ID 23468
UniProt ID P45973
Cytogenetics 12q13.13
Summary This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HP1 alpha (CBX5) (NM_001127321) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301515 CBX5 MS Standard C13 and N15-labeled recombinant protein (NP_036249) 10 ug
$3,255.00
LC402149 CBX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426744 CBX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426745 CBX5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402149 Transient overexpression lysate of chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 3 100 ug
$436.00
LY426744 Transient overexpression lysate of chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 2 100 ug
$436.00
LY426745 Transient overexpression lysate of chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 1 100 ug
$436.00
TP301515 Recombinant protein of human chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325208 Recombinant protein of human chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760487 Purified recombinant protein of Human chromobox homolog 5 (CBX5), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.