C1orf194 (NM_001122961) Human Mass Spec Standard

SKU
PH325142
C1orf194 MS Standard C13 and N15-labeled recombinant protein (NP_001116433)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225142]
Predicted MW 17.9 kDa
Protein Sequence
Protein Sequence
>RC225142 representing NM_001122961
Red=Cloning site Green=Tags(s)

MERSPSRRRRLEEAPKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNH
HTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIHSIQGSIVSPHTA
ATNGGYSRKKDGGFFST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001116433
RefSeq ORF 471
Locus ID 127003
UniProt ID Q5T5A4
Cytogenetics 1p13.3
Summary May play an important role for the maintenance of myelin-axon integrity (By similarity). May affect intracellular Ca(2+) homeostasis (PubMed:31199454).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C1orf194 (NM_001122961) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC426588 C1orf194 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY426588 Transient overexpression lysate of chromosome 1 open reading frame 194 (C1orf194) 100 ug
$436.00
TP325142 Recombinant protein of human chromosome 1 open reading frame 194 (C1orf194), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.