SYCE3 (NM_001123225) Human Mass Spec Standard

SKU PH325004

C22orf41 MS Standard C13 and N15-labeled recombinant protein (NP_001116697)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC225004]
• Predicted MW: 10.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC225004 representing NM_001123225; Red=Cloning site Green=Tags(s); ; MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK; EEMEKNWQELLHETKQRL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001116697
• RefSeq ORF: 264
• Synonyms: C22orf41; THEG2
• Locus ID: 644186
• UniProt ID: A1L190
• Cytogenetics: 22q13.33
• Summary: Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.[UniProtKB/Swiss-Prot Function]