INCA (CARD17) (NM_001007232) Human Mass Spec Standard

SKU PH324934

CARD17 MS Standard C13 and N15-labeled recombinant protein (NP_001007233)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC224934]
• Predicted MW: 11.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC224934 representing NM_001007232; Red=Cloning site Green=Tags(s); ; MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQ; ICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001007233
• RefSeq Size: 466
• RefSeq ORF: 330
• Synonyms: INCA
• Locus ID: 440068
• UniProt ID: Q5XLA6
• Cytogenetics: 11q22.3
• Summary: Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.[UniProtKB/Swiss-Prot Function]