FIZ1 (NM_032836) Human Mass Spec Standard

SKU
PH324773
FIZ1 MS Standard C13 and N15-labeled recombinant protein (NP_116225)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224773]
Predicted MW 51.8 kDa
Protein Sequence
Protein Sequence
>RC224773 representing NM_032836
Red=Cloning site Green=Tags(s)

MDDVPAPTPAPAPPAAAAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHL
RSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSSLGRHLKRQHRGVLPSPLQP
GPGLPALSAPCSVCCNVGPCSVCGGSGAGGGEGPEGAGAGLGSWGLAEAAAAAAASLPPFACGACARRFD
HGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWAAGPGAGPETAGEGTAA
EAGDAPLASDRRLLLGPAGGGVPKLGGLLPEGGGEAPAPAAAAEPSEDTLYQCDCGTFFASAAALASHLE
AHSGPATYGCGHCGALYAALAALEEHRRVSHGEGGGEEAAAAAREREPASGEPPSGSGRGKKIFGCSECE
KLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFPCHICGKGFITLSNLSRHLK
LHRGMD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116225
RefSeq Size 2651
RefSeq ORF 1488
Synonyms ZNF798
Locus ID 84922
UniProt ID Q96SL8
Cytogenetics 19q13.42
Summary This gene encodes zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. This gene product also interacts with a transcription factor that regulates the expression of rod-specific genes in retina. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FIZ1 (NM_032836) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403209 FIZ1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403209 Transient overexpression lysate of FLT3-interacting zinc finger 1 (FIZ1) 100 ug
$665.00
TP324773 Recombinant protein of human FLT3-interacting zinc finger 1 (FIZ1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.