OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERMAP (NM_018538) Human Mass Spec Standard

Be the first to review this product
SKU
PH324743
ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_061008)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500911 Anti-ERMAP mouse monoclonal antibody, clone OTIC8 (formerly C8) 100 ul
$447.00
LY413005 Transient overexpression lysate of erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "ERMAP or NM_018538"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224743
Predicted MW 52.6 kDa
Protein Sequence
Protein Sequence
>RC224743 protein sequence
Red=Cloning site Green=Tags(s)

MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPF
PQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVI
LQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHK
AVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVV
SILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFR
LKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE
SIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061008
RefSeq Size 3381
RefSeq ORF 1425
Synonyms BTN5; PRO2801; RD; SC
Locus ID 114625
UniProt ID Q96PL5
Cytogenetics 1p34.2
Summary The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERMAP" proteins (7)
SKU Description Size Price
PH315022 ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_001017922) 10 ug
$3,360.00
LC413005 Lyophilized ERMAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422752 Lyophilized ERMAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413005 Transient overexpression lysate of erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422752 Transient overexpression lysate of erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP315022 Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 1, 20 µg 20 ug
$867.00
TP324743 Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products