hnRNP R (HNRNPR) (NM_001102397) Human Mass Spec Standard

SKU
PH324683
HNRNPR MS Standard C13 and N15-labeled recombinant protein (NP_001095867)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224683]
Predicted MW 59.5 kDa
Protein Sequence
Protein Sequence
>RC224683 representing NM_001102397
Red=Cloning site Green=Tags(s)

MKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGK
IPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCI
SVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMS
GKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHF
EDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIRGRGR
GGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAP
PPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQ
QNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001095867
RefSeq Size 2585
RefSeq ORF 1596
Synonyms hnRNP-R; HNRPR
Locus ID 10236
UniProt ID Q0VGD6
Cytogenetics 1p36.12
Summary This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:hnRNP R (HNRNPR) (NM_001102397) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH324502 HNRNPR MS Standard C13 and N15-labeled recombinant protein (NP_005817) 10 ug
$3,255.00
LC417046 HNRNPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420140 HNRNPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417046 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 2 100 ug
$665.00
LY420140 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 4 100 ug
$665.00
TP324502 Recombinant protein of human heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324683 Recombinant protein of human heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.