Cyt 19 (AS3MT) (NM_020682) Human Mass Spec Standard

SKU
PH324597
AS3MT MS Standard C13 and N15-labeled recombinant protein (NP_065733)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224597]
Predicted MW 41.6 kDa
Protein Sequence
Protein Sequence
>RC224597 representing NM_020682
Red=Cloning site Green=Tags(s)

MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLE
NCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLG
EAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGA
LYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGIT
GHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLA
EESDSMKSRCVPDAAGGCCGTKKSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065733
RefSeq Size 2477
RefSeq ORF 1125
Synonyms CYT19
Locus ID 57412
UniProt ID Q9HBK9
Cytogenetics 10q24.32
Summary AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Cyt 19 (AS3MT) (NM_020682) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412380 AS3MT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412380 Transient overexpression lysate of arsenic (+3 oxidation state) methyltransferase (AS3MT) 100 ug
$436.00
TP324597 Recombinant protein of human arsenic (+3 oxidation state) methyltransferase (AS3MT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761233 Purified recombinant protein of Human arsenic (+3 oxidation state) methyltransferase (AS3MT), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.