GIPC (GIPC1) (NM_202468) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC224373] |
Predicted MW | 36 kDa |
Protein Sequence |
Protein Sequence
>RC224373 protein sequence
Red=Cloning site Green=Tags(s) MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_974197 |
RefSeq Size | 1908 |
RefSeq ORF | 999 |
Synonyms | C19orf3; GIPC; GLUT1CBP; Hs.6454; IIP-1; NIP; OPDM2; RGS19IP1; SEMCAP; SYNECTIIN; SYNECTIN; TIP-2 |
Locus ID | 10755 |
UniProt ID | O14908 |
Cytogenetics | 19p13.12 |
Summary | GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM, Apr 2009] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301175 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974199) | 10 ug |
$3,255.00
|
|
PH316466 | GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_005707) | 10 ug |
$3,255.00
|
|
LC404361 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404363 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417114 | GIPC1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404361 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3 | 100 ug |
$436.00
|
|
LY404363 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5 | 100 ug |
$436.00
|
|
LY417114 | Transient overexpression lysate of GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1 | 100 ug |
$436.00
|
|
TP301175 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP316466 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP324373 | Recombinant protein of human GIPC PDZ domain containing family, member 1 (GIPC1), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.