SIGLEC14 (NM_001098612) Human Mass Spec Standard

SKU
PH324202
SIGLEC14 MS Standard C13 and N15-labeled recombinant protein (NP_001092082)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224202]
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC224202 representing NM_001098612
Red=Cloning site Green=Tags(s)

MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEIPYYA
EVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVT
ALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTN
LTCQVKRQGAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNP
PASLSWFREGKALNPSQTSMSGTLELPNIGAREGGEFTCRVQHPLGSQHLSFILSVQRSSSSCICVTEKQ
QGSWPLVLTLIRGALMGAGFLLTYGLTWIYYTRCGGPQQSRAERPG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092082
RefSeq Size 2113
RefSeq ORF 1188
Locus ID 100049587
UniProt ID Q08ET2
Cytogenetics 19q13.41
Summary Putative adhesion molecule. Sialic acid-binding paired receptor which may activate associated receptors.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SIGLEC14 (NM_001098612) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420640 SIGLEC14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420640 Transient overexpression lysate of sialic acid binding Ig-like lectin 14 (SIGLEC14) 100 ug
$436.00
TP324202 Recombinant protein of human sialic acid binding Ig-like lectin 14 (SIGLEC14), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.