GNAT3 (NM_001102386) Human Mass Spec Standard

SKU
PH324201
GNAT3 MS Standard C13 and N15-labeled recombinant protein (NP_001095856)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224201]
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC224201 representing NM_001102386
Red=Cloning site Green=Tags(s)

MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEQECMEFK
AVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQACF
ERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKK
WIHCFEGVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTK
VHLSICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD
CGLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001095856
RefSeq Size 1065
RefSeq ORF 1062
Synonyms GDCA
Locus ID 346562
UniProt ID A8MTJ3
Cytogenetics 7q21.11
Summary Sweet, bitter, and umami tastes are transmitted from taste receptors by a specific guanine nucleotide binding protein. The protein encoded by this gene is the alpha subunit of this heterotrimeric G protein, which is found not only in the oral epithelium but also in gut tissues. Variations in this gene have been linked to metabolic syndrome. [provided by RefSeq, Dec 2015]
Protein Pathways Taste transduction
Write Your Own Review
You're reviewing:GNAT3 (NM_001102386) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420138 GNAT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420138 Transient overexpression lysate of guanine nucleotide binding protein, alpha transducing 3 (GNAT3) 100 ug
$436.00
TP324201 Recombinant protein of human guanine nucleotide binding protein, alpha transducing 3 (GNAT3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.